PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Medtr5g007300.1
Common NameMTR_5g007300
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
Family MYB_related
Protein Properties Length: 141aa    MW: 16318.9 Da    PI: 10.6723
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Medtr5g007300.1genomeMtView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding60.24.4e-1966113148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +g+W+ eEd++lvd ++++G+g+W+  +r+ g++R++k+c++rw +yl
  Medtr5g007300.1  66 KGPWSSEEDKKLVDHIQKHGPGRWRDLPRRAGLNRCGKSCRLRWTNYL 113
                      79********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.605.8E-2461116IPR009057Homeodomain-like
PROSITE profilePS5129425.05461117IPR017930Myb domain
SMARTSM007171.2E-1465115IPR001005SANT/Myb domain
PfamPF002498.2E-1766113IPR001005SANT/Myb domain
SuperFamilySSF466892.12E-2367140IPR009057Homeodomain-like
CDDcd001678.58E-1168113No hitNo description
Gene3DG3DSA:1.10.10.601.5E-8117140IPR009057Homeodomain-like
PROSITE profilePS512948.799118140IPR017930Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 141 aa     Download sequence    Send to blast
MKIIKSKLRN KINNVWFNDL MICYTEREIF KSLDDVDIIR TFTAKRSRKS AVMMTTPSNG  60
KSGLKKGPWS SEEDKKLVDH IQKHGPGRWR DLPRRAGLNR CGKSCRLRWT NYLSPDIKRG  120
KFSDEEEELI INLHSVLGNK *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C8e-216414025100MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1267921e-153AC126792.15 Medicago truncatula clone mth2-8o8, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003610812.21e-100myb transcription factor
SwissprotQ7XBH41e-37MYB4_ORYSJ; Myb-related protein Myb4
TrEMBLG7K5511e-100G7K551_MEDTR; Myb transcription factor
STRINGGLYMA01G44370.26e-44(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF3134817
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G16770.23e-44myb domain protein 9
Publications ? help Back to Top
  1. Young ND, et al.
    The Medicago genome provides insight into the evolution of rhizobial symbioses.
    Nature, 2011. 480(7378): p. 520-4
    [PMID:22089132]